(data stored in SCRATCH zone)

EMBL: AP010803.PE384

AP010803.PE384       Location/Qualifiers
FT   CDS             complement(395135..395929)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03840"
FT                   /product="putative gluconate 5-dehydrogenase"
FT                   /EC_number="1.1.1.69"
FT                   /note="short-chain dehydrogenase/reductase (SDR) family
FT                   protein / trans-2-enoyl-CoA reductase (NADPH) (EC
FT                   1.3.1.38)"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03840"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95218"
FT                   /db_xref="GOA:D4YXY6"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXY6"
FT                   /protein_id="BAI95218.1"
FT                   /translation="MADWNPGFTAAQFRLDGKRALITGGRGALAEAMAATLADLGCAVA
FT                   LASRTEADCADLAAGIAERFRVPAIGLSCNIADEASVEAAVAGTVDRLGGLDILINNAG
FT                   ASWWGLPQDIPLKGWQKVMDVNVTGTFLACRHAARHMIAAGGGAIVNIASVGAFLSYQP
FT                   DAGQVVPYTTSKAAIVHLTSDLAAQWAGHNIRVNAIAPGSIETGMTETLDPAIQERTRA
FT                   GILMRRFGRPEEVAGTLALLASDAGSFITGQTFLVDGGQSLA"
     MADWNPGFTA AQFRLDGKRA LITGGRGALA EAMAATLADL GCAVALASRT EADCADLAAG        60
     IAERFRVPAI GLSCNIADEA SVEAAVAGTV DRLGGLDILI NNAGASWWGL PQDIPLKGWQ       120
     KVMDVNVTGT FLACRHAARH MIAAGGGAIV NIASVGAFLS YQPDAGQVVP YTTSKAAIVH       180
     LTSDLAAQWA GHNIRVNAIA PGSIETGMTE TLDPAIQERT RAGILMRRFG RPEEVAGTLA       240
     LLASDAGSFI TGQTFLVDGG QSLA                                              264
//

If you have problems or comments...

PBIL Back to PBIL home page