(data stored in SCRATCH zone)

EMBL: AP010803.PE385

AP010803.PE385       Location/Qualifiers
FT   CDS             complement(395922..396260)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03850"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03850"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95219"
FT                   /db_xref="InterPro:IPR009799"
FT                   /db_xref="InterPro:IPR011008"
FT                   /db_xref="InterPro:IPR018566"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXY7"
FT                   /protein_id="BAI95219.1"
FT                   /translation="MAVSMVVLASRPRDWTQEQFTNWWRGPHADAARVLPGLIAYRHGA
FT                   VTKDYDNPEAPGWDGHAVLTFADQAALDAAFASPEWKAATAQTKGMGGRRIILITDEVD
FT                   LLAGDDHG"
     MAVSMVVLAS RPRDWTQEQF TNWWRGPHAD AARVLPGLIA YRHGAVTKDY DNPEAPGWDG        60
     HAVLTFADQA ALDAAFASPE WKAATAQTKG MGGRRIILIT DEVDLLAGDD HG               112
//

If you have problems or comments...

PBIL Back to PBIL home page