(data stored in SCRATCH zone)

EMBL: AP010803.PE387

AP010803.PE387       Location/Qualifiers
FT   CDS             complement(397104..397811)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03870"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03870"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95221"
FT                   /db_xref="GOA:D4YXY9"
FT                   /db_xref="InterPro:IPR003779"
FT                   /db_xref="InterPro:IPR029032"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXY9"
FT                   /protein_id="BAI95221.1"
FT                   /translation="MTNSPLMEVALLRGYAPYTLAGYDIFRSVIESDGAVPARLKALFA
FT                   AVAAVDRRHLSLARRELERGVSLGLTSKEATAGLIVLSSLRGEAAALDFAQIIEESFGD
FT                   AQAPVPQPLPKAAEGEAEANFRAYWAGSIPAPLGALMRLAPEAADAYYLMRRGSIDANP
FT                   LSAKYGELLLLAILAAGYSPMAATHVRGARNAGASDEEIAEAVLCAIPSAGIAAWMAVG
FT                   GMLAPPEEGGIAR"
     MTNSPLMEVA LLRGYAPYTL AGYDIFRSVI ESDGAVPARL KALFAAVAAV DRRHLSLARR        60
     ELERGVSLGL TSKEATAGLI VLSSLRGEAA ALDFAQIIEE SFGDAQAPVP QPLPKAAEGE       120
     AEANFRAYWA GSIPAPLGAL MRLAPEAADA YYLMRRGSID ANPLSAKYGE LLLLAILAAG       180
     YSPMAATHVR GARNAGASDE EIAEAVLCAI PSAGIAAWMA VGGMLAPPEE GGIAR            235
//

If you have problems or comments...

PBIL Back to PBIL home page