(data stored in ACNUC7421 zone)

EMBL: AP010803.PE393

AP010803.PE393       Location/Qualifiers
FT   CDS             complement(404671..405417)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03930"
FT                   /product="LinC-like dehydrogenase"
FT                   /note="short-chain dehydrogenase/reductase (SDR) family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03930"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95227"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4YXZ5"
FT                   /protein_id="BAI95227.1"
FT                   /translation="MATKGRVEGKVVLITGAAHGLGKADAEALAREGARVIVADVDEEE
FT                   AQRVVDMLPAAMALRLDVTCEAQWQAALTKIMQAYGRLDGLVNNAGIAAFETVEQSSLE
FT                   AFRRVMAVSAEGTFLGCKTCLPALAASGAGSIVNIASVAAIRGNPAVFAYSAAKGAVLS
FT                   MTRSLIVHCQQQGYPVRANVVLPGSHDTQMVREAYRFAAPELREAARKHEGQPEHVADL
FT                   VLFLVSDESARLNGAEIVIDNGRTVG"
     MATKGRVEGK VVLITGAAHG LGKADAEALA REGARVIVAD VDEEEAQRVV DMLPAAMALR        60
     LDVTCEAQWQ AALTKIMQAY GRLDGLVNNA GIAAFETVEQ SSLEAFRRVM AVSAEGTFLG       120
     CKTCLPALAA SGAGSIVNIA SVAAIRGNPA VFAYSAAKGA VLSMTRSLIV HCQQQGYPVR       180
     ANVVLPGSHD TQMVREAYRF AAPELREAAR KHEGQPEHVA DLVLFLVSDE SARLNGAEIV       240
     IDNGRTVG                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page