(data stored in ACNUC7421 zone)

EMBL: AP010803.PE398

AP010803.PE398       Location/Qualifiers
FT   CDS             complement(409952..410374)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-03980"
FT                   /product="putative nucleic-acid-binding protein"
FT                   /note="Zn-ribbon"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-03980"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95232"
FT                   /db_xref="InterPro:IPR002878"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY00"
FT                   /protein_id="BAI95232.1"
FT                   /translation="MPDTLPVPIADDLICPDADGIALLASRERATHRLCFPARPEDDTR
FT                   YDRVLLPRTGRLWSWTVQRFRPKSPPYAGPEAFEPYAVGYVELDGALIVEGRLVDVAFD
FT                   DLAIGMAMRVVPLPFPLADGTVRTSFGFAPDGSAGI"
     MPDTLPVPIA DDLICPDADG IALLASRERA THRLCFPARP EDDTRYDRVL LPRTGRLWSW        60
     TVQRFRPKSP PYAGPEAFEP YAVGYVELDG ALIVEGRLVD VAFDDLAIGM AMRVVPLPFP       120
     LADGTVRTSF GFAPDGSAGI                                                   140
//

If you have problems or comments...

PBIL Back to PBIL home page