(data stored in ACNUC7421 zone)

EMBL: AP010803.PE40

AP010803.PE40        Location/Qualifiers
FT   CDS             complement(41067..42104)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00400"
FT                   /product="DNA polymerase III delta subunit"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00400"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94874"
FT                   /db_xref="GOA:D4YWZ2"
FT                   /db_xref="InterPro:IPR008921"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4YWZ2"
FT                   /protein_id="BAI94874.1"
FT                   /translation="MKANRGQIEKALDAAGQGLAPDCRFFLLHGPDEAGSAALAKRLER
FT                   AMGPDAERIDLDPSTLRDDPARLADEAASFSMFGDRRWIRVTGMGEESVPALNALLEAE
FT                   AAGNPVIAVAGALKGTSKLLKLALDHKQTMAFASYQPDAREAEQIAVAIGREGGLRLSP
FT                   ELGRRIADLTNGDRTLMAGEVEKLILYLDAAPDRPREATEEALDALSADNPDSDAAPLV
FT                   NAVLGGDLRGMHRELGRLAEAGTAMAAVLRPLLTRAMLLANIRADFDESGRLDGAVEAA
FT                   GKAVFWKEKGVVTRQVRIWDAAGIARVIQRLAQAERASRSGRGLGDLMVRHELLAIARQ
FT                   AARER"
     MKANRGQIEK ALDAAGQGLA PDCRFFLLHG PDEAGSAALA KRLERAMGPD AERIDLDPST        60
     LRDDPARLAD EAASFSMFGD RRWIRVTGMG EESVPALNAL LEAEAAGNPV IAVAGALKGT       120
     SKLLKLALDH KQTMAFASYQ PDAREAEQIA VAIGREGGLR LSPELGRRIA DLTNGDRTLM       180
     AGEVEKLILY LDAAPDRPRE ATEEALDALS ADNPDSDAAP LVNAVLGGDL RGMHRELGRL       240
     AEAGTAMAAV LRPLLTRAML LANIRADFDE SGRLDGAVEA AGKAVFWKEK GVVTRQVRIW       300
     DAAGIARVIQ RLAQAERASR SGRGLGDLMV RHELLAIARQ AARER                       345
//

If you have problems or comments...

PBIL Back to PBIL home page