(data stored in ACNUC7421 zone)

EMBL: AP010803.PE401

AP010803.PE401       Location/Qualifiers
FT   CDS             411977..412729
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04010"
FT                   /product="SDR-family protein"
FT                   /note="short-chain dehydrogenase/reductase (SDR) family
FT                   protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04010"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95235"
FT                   /db_xref="GOA:D4YY03"
FT                   /db_xref="InterPro:IPR002347"
FT                   /db_xref="InterPro:IPR020904"
FT                   /db_xref="InterPro:IPR036291"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY03"
FT                   /protein_id="BAI95235.1"
FT                   /translation="MQVEGKTALVTGASSGLGRHFARLLAREGATVVAAARRVDALSAL
FT                   SDEIGRQGGTCIPVAMDVTDPDAVAAAFGQIERDLAAPLSILVNNAGVAHTRAALDLSA
FT                   SEWSQVLQPNLTGAFLVAQQAARMMRGQGGTIVNVASILGERVSKGLAAYAASKAGLIQ
FT                   LTKALALEWAAFDIRVNALAPGYIETDLNRDFFASDAGQRLISRIPQKRLGQMQDLDGP
FT                   LLLLCSDQSRYMTGAVIAVDGGHLVSGL"
     MQVEGKTALV TGASSGLGRH FARLLAREGA TVVAAARRVD ALSALSDEIG RQGGTCIPVA        60
     MDVTDPDAVA AAFGQIERDL AAPLSILVNN AGVAHTRAAL DLSASEWSQV LQPNLTGAFL       120
     VAQQAARMMR GQGGTIVNVA SILGERVSKG LAAYAASKAG LIQLTKALAL EWAAFDIRVN       180
     ALAPGYIETD LNRDFFASDA GQRLISRIPQ KRLGQMQDLD GPLLLLCSDQ SRYMTGAVIA       240
     VDGGHLVSGL                                                              250
//

If you have problems or comments...

PBIL Back to PBIL home page