(data stored in ACNUC7421 zone)

EMBL: AP010803.PE402

AP010803.PE402       Location/Qualifiers
FT   CDS             complement(412839..414272)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04020"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized protein conserved in bacteria / DNA
FT                   recombination protein RmuC"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04020"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95236"
FT                   /db_xref="InterPro:IPR003798"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY04"
FT                   /protein_id="BAI95236.1"
FT                   /translation="MDSLAAILVIVALVAGLGIGWLAKGRSMAPLLAEKADLAGKLDMA
FT                   ATQRNAAIQELVVAQERAAQAADLARKLEAERAGREAAARELAALRSDAQARAEAFEAQ
FT                   IAALKDAKEQLSAQFSEIGGKLLHQAQSHFLERADQRMMQAHEKSEAQLRQLLHPVNET
FT                   IQRYDQKITQIEQQRTEAYGILRGEIESMKTGQEAVRAEAQRLVDSLRHAPKARGRWGE
FT                   QQLRNVLETCGLSEHVDFQTEVSVEGEDGRLRPDAILRVPGGRALVIDAKVSLNAYQDA
FT                   YGAEGDEERKRLLSAHAAAMRAHVETLGRKSYAEQFDDAPDYVIMFVPGEHFLSAALEH
FT                   DPQLWDHAFAKRVLLATPTNLIAIARTVAAVWRQEKMADEAKRIGMLGKELYERLAGAA
FT                   GSLKKLGNRLNGAVADYNSFVGSFEGRVLVTGRKLRDLNIETGGKELEELEPVEALVRE
FT                   PSSAEAVRALPDALPDAAE"
     MDSLAAILVI VALVAGLGIG WLAKGRSMAP LLAEKADLAG KLDMAATQRN AAIQELVVAQ        60
     ERAAQAADLA RKLEAERAGR EAAARELAAL RSDAQARAEA FEAQIAALKD AKEQLSAQFS       120
     EIGGKLLHQA QSHFLERADQ RMMQAHEKSE AQLRQLLHPV NETIQRYDQK ITQIEQQRTE       180
     AYGILRGEIE SMKTGQEAVR AEAQRLVDSL RHAPKARGRW GEQQLRNVLE TCGLSEHVDF       240
     QTEVSVEGED GRLRPDAILR VPGGRALVID AKVSLNAYQD AYGAEGDEER KRLLSAHAAA       300
     MRAHVETLGR KSYAEQFDDA PDYVIMFVPG EHFLSAALEH DPQLWDHAFA KRVLLATPTN       360
     LIAIARTVAA VWRQEKMADE AKRIGMLGKE LYERLAGAAG SLKKLGNRLN GAVADYNSFV       420
     GSFEGRVLVT GRKLRDLNIE TGGKELEELE PVEALVREPS SAEAVRALPD ALPDAAE          477
//

If you have problems or comments...

PBIL Back to PBIL home page