(data stored in ACNUC7421 zone)

EMBL: AP010803.PE405

AP010803.PE405       Location/Qualifiers
FT   CDS             complement(416221..416976)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04050"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04050"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95239"
FT                   /db_xref="GOA:D4YY07"
FT                   /db_xref="InterPro:IPR007560"
FT                   /db_xref="InterPro:IPR011335"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY07"
FT                   /protein_id="BAI95239.1"
FT                   /translation="MVQLLTATLEQRRSCFTKLIVAIVRQAMTYRRGKGNPLSREEIDR
FT                   LNSLLPGVQFKIPELLDPSFLSSFGSPKAAERAPQASSTLGAEKEQELAALLIEITKLD
FT                   PQARGLRFEGFLNELFAGFGLAPRGSFRLVGEQIDGSFKLHGQTYLVEAKWHGPQIGFA
FT                   DLMTFSGKVGGKASWSRGLFVSNSGFTAEGLEAFSRGRQTNLICADGLDLYEVLSRKVS
FT                   LITVLEAKERRAAETNRAFVAVRDLNLGG"
     MVQLLTATLE QRRSCFTKLI VAIVRQAMTY RRGKGNPLSR EEIDRLNSLL PGVQFKIPEL        60
     LDPSFLSSFG SPKAAERAPQ ASSTLGAEKE QELAALLIEI TKLDPQARGL RFEGFLNELF       120
     AGFGLAPRGS FRLVGEQIDG SFKLHGQTYL VEAKWHGPQI GFADLMTFSG KVGGKASWSR       180
     GLFVSNSGFT AEGLEAFSRG RQTNLICADG LDLYEVLSRK VSLITVLEAK ERRAAETNRA       240
     FVAVRDLNLG G                                                            251
//

If you have problems or comments...

PBIL Back to PBIL home page