(data stored in ACNUC7421 zone)

EMBL: AP010803.PE408

AP010803.PE408       Location/Qualifiers
FT   CDS             complement(420760..423312)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04080"
FT                   /product="putative subtilisin proteinase-like protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04080"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95242"
FT                   /db_xref="GOA:D4YY10"
FT                   /db_xref="InterPro:IPR000209"
FT                   /db_xref="InterPro:IPR034074"
FT                   /db_xref="InterPro:IPR036852"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY10"
FT                   /protein_id="BAI95242.1"
FT                   /translation="MAEPDNFDARDRPHIAIDVFRETAAYTFPSRNQERKPLRGDYAAH
FT                   ATQLLDQLAAALGTVPVAAADPRLPVQGLKSGTVVEVTTLPPAEGSRTKAVKVPATLEF
FT                   PTQDVVILRSERNEDRTESALLFVPDDARAFLRNRITDYGRDPGNQRRPDVERFEVIEE
FT                   VRAVEVGSLFTGVVDLAAPDILWWELWVRQPVALADRLAAAARNANIDVHDDRLIFPDT
FT                   TVVFLHAAAAAVAAFAARVPGAITEIRRATGTIEPFLDRGDTGFGQHDWVDELAQRVSP
FT                   PSPDAPVVCTLDTGVTAAHPLIAPGLRGAWAYDADWGADDHEPYGGHGTPLAGLVLYGD
FT                   LEPLMNDARPVDLTHGAESMKLLPPGGFPPTKPPSYGVVTQGAVSLVEIERPEAVRSFC
FT                   IATSATDFPPSRPSTWSGAIDQISAGAMPGEADDAVPAAERSKRLIVVATGNVSGGMAV
FT                   DVLPSQPLEDPSQSWNALTIGGFTRKEQPPAPPPVLQAAVPANHRSPFSRGSQSLPDDL
FT                   TPIKPEVLFEAGNMMSDATGFCGWDPAVSLLSAGSDVATEPLVPFWATSAAAGMAGNFI
FT                   GRLQAARPDLWAETHRALTVDSARWPEPIRKRFIGTGAHWKTGKAATKGKKQEMLREFG
FT                   YGVPDIDRAILSARNDATLVAQAEIQPFAIGADGRTGVFNEMHFYDLPWPKAALEKLEN
FT                   EIVTMKVTLSYFIEPNLAGKAATRPDTYRSFGLRFDMKKRTETAARFRSRISASQAKDG
FT                   TEADGEASCWLLGPKAIQAGSLHCDLWRGRAIELAGHDAIAVYPVGGWWKSHVGQKRVA
FT                   DKARYALVISISAPGQDVDLYSEINTLVENKEIEVLLG"
     MAEPDNFDAR DRPHIAIDVF RETAAYTFPS RNQERKPLRG DYAAHATQLL DQLAAALGTV        60
     PVAAADPRLP VQGLKSGTVV EVTTLPPAEG SRTKAVKVPA TLEFPTQDVV ILRSERNEDR       120
     TESALLFVPD DARAFLRNRI TDYGRDPGNQ RRPDVERFEV IEEVRAVEVG SLFTGVVDLA       180
     APDILWWELW VRQPVALADR LAAAARNANI DVHDDRLIFP DTTVVFLHAA AAAVAAFAAR       240
     VPGAITEIRR ATGTIEPFLD RGDTGFGQHD WVDELAQRVS PPSPDAPVVC TLDTGVTAAH       300
     PLIAPGLRGA WAYDADWGAD DHEPYGGHGT PLAGLVLYGD LEPLMNDARP VDLTHGAESM       360
     KLLPPGGFPP TKPPSYGVVT QGAVSLVEIE RPEAVRSFCI ATSATDFPPS RPSTWSGAID       420
     QISAGAMPGE ADDAVPAAER SKRLIVVATG NVSGGMAVDV LPSQPLEDPS QSWNALTIGG       480
     FTRKEQPPAP PPVLQAAVPA NHRSPFSRGS QSLPDDLTPI KPEVLFEAGN MMSDATGFCG       540
     WDPAVSLLSA GSDVATEPLV PFWATSAAAG MAGNFIGRLQ AARPDLWAET HRALTVDSAR       600
     WPEPIRKRFI GTGAHWKTGK AATKGKKQEM LREFGYGVPD IDRAILSARN DATLVAQAEI       660
     QPFAIGADGR TGVFNEMHFY DLPWPKAALE KLENEIVTMK VTLSYFIEPN LAGKAATRPD       720
     TYRSFGLRFD MKKRTETAAR FRSRISASQA KDGTEADGEA SCWLLGPKAI QAGSLHCDLW       780
     RGRAIELAGH DAIAVYPVGG WWKSHVGQKR VADKARYALV ISISAPGQDV DLYSEINTLV       840
     ENKEIEVLLG                                                              850
//

If you have problems or comments...

PBIL Back to PBIL home page