(data stored in ACNUC7421 zone)

EMBL: AP010803.PE41

AP010803.PE41        Location/Qualifiers
FT   CDS             complement(42101..42595)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00410"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative secreted (periplasmic) protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00410"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94875"
FT                   /db_xref="GOA:D4YWZ3"
FT                   /db_xref="InterPro:IPR007485"
FT                   /db_xref="UniProtKB/TrEMBL:D4YWZ3"
FT                   /protein_id="BAI94875.1"
FT                   /translation="MKLWPLLFVTLSLSACGLRPVYSGGSHGAVAQALGNVAVQPIEGK
FT                   GGWLVRNALNDRLAAMSGTGPGYRLVVKLDDNISGFGLRSDAAITRERRTLRARYQLID
FT                   EATGAQILDDTAGSDVGIDVVSSEYATIAAEDTALERLSQTIADQIVARLARFAARDKG
FT                   R"
     MKLWPLLFVT LSLSACGLRP VYSGGSHGAV AQALGNVAVQ PIEGKGGWLV RNALNDRLAA        60
     MSGTGPGYRL VVKLDDNISG FGLRSDAAIT RERRTLRARY QLIDEATGAQ ILDDTAGSDV       120
     GIDVVSSEYA TIAAEDTALE RLSQTIADQI VARLARFAAR DKGR                        164
//

If you have problems or comments...

PBIL Back to PBIL home page