(data stored in ACNUC7421 zone)

EMBL: AP010803.PE411

AP010803.PE411       Location/Qualifiers
FT   CDS             424733..425458
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04110"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04110"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95245"
FT                   /db_xref="InterPro:IPR017026"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY13"
FT                   /protein_id="BAI95245.1"
FT                   /translation="MRAQIEKIEGRGRRAKSVLPFGIAAMDSRLPGEGLALGALHEVAG
FT                   GGNGAIDGAAAALFSAGVAARTKGKVLWCITRPDLFAPAIAQAGLAADRVIYVEAGDDK
FT                   TVLACMEEGLRHGGLGAVVGEVARLSMTASRRLQLAAEGGGAIAIALRRWRRQTEAADF
FT                   GQPTAAMTRWRISVLPSTPLPVPGVGRPRSLVELIRARAGESADFELEACDDTGRLALP
FT                   AELVHRPAAAEGWRRGASG"
     MRAQIEKIEG RGRRAKSVLP FGIAAMDSRL PGEGLALGAL HEVAGGGNGA IDGAAAALFS        60
     AGVAARTKGK VLWCITRPDL FAPAIAQAGL AADRVIYVEA GDDKTVLACM EEGLRHGGLG       120
     AVVGEVARLS MTASRRLQLA AEGGGAIAIA LRRWRRQTEA ADFGQPTAAM TRWRISVLPS       180
     TPLPVPGVGR PRSLVELIRA RAGESADFEL EACDDTGRLA LPAELVHRPA AAEGWRRGAS       240
     G                                                                       241
//

If you have problems or comments...

PBIL Back to PBIL home page