(data stored in ACNUC7421 zone)

EMBL: AP010803.PE414

AP010803.PE414       Location/Qualifiers
FT   CDS             complement(430203..430793)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04140"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04140"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95248"
FT                   /db_xref="GOA:D4YY16"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="InterPro:IPR036590"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY16"
FT                   /protein_id="BAI95248.1"
FT                   /translation="MCNDYRLTVDVASIVEDFADLKIKIRFGEGAPNIAARDDIKITDV
FT                   GAIVRTIEGVRGEGDLVQRRWSWPGQNKRPVYNFRSEGRAFGSNRCLIVADGFYEFTDA
FT                   AEKGKKRKDKWLFTKRDEPIFCIGGIWRETKEVGEAFTMLTMEPGPDIAPYHDRQIVIL
FT                   ERDAWTGWLNPSVPAQSLIRPLPAGSLLVEQVG"
     MCNDYRLTVD VASIVEDFAD LKIKIRFGEG APNIAARDDI KITDVGAIVR TIEGVRGEGD        60
     LVQRRWSWPG QNKRPVYNFR SEGRAFGSNR CLIVADGFYE FTDAAEKGKK RKDKWLFTKR       120
     DEPIFCIGGI WRETKEVGEA FTMLTMEPGP DIAPYHDRQI VILERDAWTG WLNPSVPAQS       180
     LIRPLPAGSL LVEQVG                                                       196
//

If you have problems or comments...

PBIL Back to PBIL home page