(data stored in ACNUC7421 zone)

EMBL: AP010803.PE415

AP010803.PE415       Location/Qualifiers
FT   CDS             430853..431353
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04150"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized conserved protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04150"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95249"
FT                   /db_xref="InterPro:IPR003738"
FT                   /db_xref="InterPro:IPR036590"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY17"
FT                   /protein_id="BAI95249.1"
FT                   /translation="MSATAFDSDASLDERRVIIRRGGGDVEMVKLPWGLQPREIGGRPF
FT                   TVLRAEDRTFPSHRCLVPASEFCHRSGGKHYSFALANGEWFYFAGIWRPATRDWPDAYA
FT                   ILTIGANADVEPYHDRQMAVLRRDQRMAWLDLTCPEAELLRPLPAGSFRVSRLREARAA
FT                   LAF"
     MSATAFDSDA SLDERRVIIR RGGGDVEMVK LPWGLQPREI GGRPFTVLRA EDRTFPSHRC        60
     LVPASEFCHR SGGKHYSFAL ANGEWFYFAG IWRPATRDWP DAYAILTIGA NADVEPYHDR       120
     QMAVLRRDQR MAWLDLTCPE AELLRPLPAG SFRVSRLREA RAALAF                      166
//

If you have problems or comments...

PBIL Back to PBIL home page