(data stored in ACNUC7421 zone)

EMBL: AP010803.PE416

AP010803.PE416       Location/Qualifiers
FT   CDS             complement(431418..433307)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04160"
FT                   /product="putative signal transduction protein"
FT                   /note="putative signal transduction protein containing a
FT                   membrane domain, an EAL and a GGDEF domain"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04160"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95250"
FT                   /db_xref="InterPro:IPR000160"
FT                   /db_xref="InterPro:IPR001633"
FT                   /db_xref="InterPro:IPR003018"
FT                   /db_xref="InterPro:IPR029016"
FT                   /db_xref="InterPro:IPR029787"
FT                   /db_xref="InterPro:IPR035919"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY18"
FT                   /protein_id="BAI95250.1"
FT                   /translation="MPLLQVENRILRLIANGVSLEETARQLCLEIEALLPDVVCTLMTV
FT                   DPAGLLHPLATPSLPDAYALAIDGVMIGPEVGSCGTAAYMRKTVGIADIAADPRWARYK
FT                   DHALVAGLKACWSYPIISESGDPIGVLALYFREHRGPREAEMGVISTALDLCGMALRRH
FT                   ERVVDRERRANVDVLTGLPNRAAFNAALECMPCDEPGIWALFMIDLDNLKIVNDTFGHL
FT                   AGDRLIQVAAARIARAVAPDVTFRIGGDEFAVLVQAPALLSDLDAAARRIFRGLELAAP
FT                   CEGHMVVPQATIGGAVFGPSESTAAAVSEAADFALYHAKETGRGGFVRYWPGIGTRITH
FT                   RRDAIRDVAAALGDGRIEAHYQPIVGLDTGEIVGLEALCRMRGRDGTLIAAHEFHEATA
FT                   DAHIAAELTEHMAAMIAGDMVRWRDQGLRVGHVGLNVSSADFYTGSISKKLERAFGPVG
FT                   VPLDQLVVEVSEDVYIGRRDGVVAREIERLRATGVRVALDDFGTGHASLTHVLNVPVDI
FT                   IKIDRSFVERLWPDDPSIVIVEGLIKIARRLEIMVIAEGIETEVQASQLWSMGCMLGQG
FT                   FAFARATDRDATAALLRRHAAGIAGVTPLYAGRKGMLREPDAAAPARRRTAAG"
     MPLLQVENRI LRLIANGVSL EETARQLCLE IEALLPDVVC TLMTVDPAGL LHPLATPSLP        60
     DAYALAIDGV MIGPEVGSCG TAAYMRKTVG IADIAADPRW ARYKDHALVA GLKACWSYPI       120
     ISESGDPIGV LALYFREHRG PREAEMGVIS TALDLCGMAL RRHERVVDRE RRANVDVLTG       180
     LPNRAAFNAA LECMPCDEPG IWALFMIDLD NLKIVNDTFG HLAGDRLIQV AAARIARAVA       240
     PDVTFRIGGD EFAVLVQAPA LLSDLDAAAR RIFRGLELAA PCEGHMVVPQ ATIGGAVFGP       300
     SESTAAAVSE AADFALYHAK ETGRGGFVRY WPGIGTRITH RRDAIRDVAA ALGDGRIEAH       360
     YQPIVGLDTG EIVGLEALCR MRGRDGTLIA AHEFHEATAD AHIAAELTEH MAAMIAGDMV       420
     RWRDQGLRVG HVGLNVSSAD FYTGSISKKL ERAFGPVGVP LDQLVVEVSE DVYIGRRDGV       480
     VAREIERLRA TGVRVALDDF GTGHASLTHV LNVPVDIIKI DRSFVERLWP DDPSIVIVEG       540
     LIKIARRLEI MVIAEGIETE VQASQLWSMG CMLGQGFAFA RATDRDATAA LLRRHAAGIA       600
     GVTPLYAGRK GMLREPDAAA PARRRTAAG                                         629
//

If you have problems or comments...

PBIL Back to PBIL home page