(data stored in ACNUC7421 zone)

EMBL: AP010803.PE419

AP010803.PE419       Location/Qualifiers
FT   CDS             435904..437691
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04190"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04190"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95253"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY21"
FT                   /protein_id="BAI95253.1"
FT                   /translation="MTAAPRKGRKVSFAADTAAPQADPWSQISTLRFMIHPLYGGELLV
FT                   DFTGLRPRGLALAFARSLFMLAAPRGPIMVRSSLKTYANQLPSFFSYLAGTGDGINGPA
FT                   DLRAHHIDGFETWLSAQGKSCVHGPTYVAKVVSVLRRIADDSPELVDCGLRERLRYVSS
FT                   HAHVRSRPRDAYSPYVARQLRDAARADIAAIEARLRSGPQFDEVPQIDGAYCKAHAAIE
FT                   TYGVLGYRDPTFQSLYKLRKKRDLTSDRLNLSLHAAHYLTADDIVPLLVLLLIETGLEL
FT                   ECCKSLTLDCLRNAAGGTVDIAYTKLRAHGAEHKTIRVRDRGSSTAGGLIRRIIALSSK
FT                   ARVHNSSDNLWVYFQPGEITAGIRQLRLKVSAWTQRHCITDDQGKPLHLCLSYLRKTHK
FT                   ALWYLKTEGHMARFAVGHTVDIAARHYADIPSLRPLHEQTVADALEEVLAGPMILPPQD
FT                   EDRLRGELASPDPDDGGISTALLNGEQDVWLASCGNFYSSPFASAGTPCPTPFWACLDC
FT                   RNAVITARKLPAILTFLSFVDAQRIGLSAADWTAKFGHAHDRIVQQILPAFAEDVVTRA
FT                   RAQVANDPPTVYLPPEARA"
     MTAAPRKGRK VSFAADTAAP QADPWSQIST LRFMIHPLYG GELLVDFTGL RPRGLALAFA        60
     RSLFMLAAPR GPIMVRSSLK TYANQLPSFF SYLAGTGDGI NGPADLRAHH IDGFETWLSA       120
     QGKSCVHGPT YVAKVVSVLR RIADDSPELV DCGLRERLRY VSSHAHVRSR PRDAYSPYVA       180
     RQLRDAARAD IAAIEARLRS GPQFDEVPQI DGAYCKAHAA IETYGVLGYR DPTFQSLYKL       240
     RKKRDLTSDR LNLSLHAAHY LTADDIVPLL VLLLIETGLE LECCKSLTLD CLRNAAGGTV       300
     DIAYTKLRAH GAEHKTIRVR DRGSSTAGGL IRRIIALSSK ARVHNSSDNL WVYFQPGEIT       360
     AGIRQLRLKV SAWTQRHCIT DDQGKPLHLC LSYLRKTHKA LWYLKTEGHM ARFAVGHTVD       420
     IAARHYADIP SLRPLHEQTV ADALEEVLAG PMILPPQDED RLRGELASPD PDDGGISTAL       480
     LNGEQDVWLA SCGNFYSSPF ASAGTPCPTP FWACLDCRNA VITARKLPAI LTFLSFVDAQ       540
     RIGLSAADWT AKFGHAHDRI VQQILPAFAE DVVTRARAQV ANDPPTVYLP PEARA            595
//

If you have problems or comments...

PBIL Back to PBIL home page