(data stored in ACNUC7421 zone)

EMBL: AP010803.PE420

AP010803.PE420       Location/Qualifiers
FT   CDS             437688..439913
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04200"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04200"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95254"
FT                   /db_xref="GOA:D4YY22"
FT                   /db_xref="InterPro:IPR011010"
FT                   /db_xref="InterPro:IPR013762"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY22"
FT                   /protein_id="BAI95254.1"
FT                   /translation="MTVVQLLAESDDERDALPVLMSAPLRPGCDRAHISRYGDPVWDLA
FT                   PGVFRDNARRCHVTVHFGGIKDPSIADALRQILHARLNVDLPGHRSRLEPAGVRGEANR
FT                   TLRFFDFVKAQLGRFDLARVDQALVDRYAGALRLAGLRPVAAAALLRIVFDLHELQHHL
FT                   PTARLSFEPWPGRSPFSVAGAKHIAGENRTPRIPEAIMTPLLSWSLRYVTCYAGDILAA
FT                   RAELDCLEATRNRLIAAEEGLDPAVRRLRQRQRLLDYVASLRQHGRGIPIWTTAHNGAT
FT                   RTDPQTGAVTPPINYHLIHLHAGINAQAEPAMHLGLATGAPDLIAAAIAELGTEIGGMD
FT                   TPNSADPDTGMPWRTRFDAKVLPLEEVMLQSAAYIVCAFLSGMRDSEIQAMRRGCLSIT
FT                   KAEDGTILRHRIKSTAYKGKRGGGEETEWVTIAPVAEAIDVLERLSARAGQARGTTTLW
FT                   PVLTLRANTKTHVSAEIVRQLNRFRDHLNDHFGSAQAPVIPAGPDGRPWRLTTRQFRRT
FT                   IAWHIANRPFGTIAGMIQYKHASVAAFEGYAGSSRSGFRGEIEAQRALGQIDDILVYFD
FT                   ERQSGARLGGPAANRVGVVLDTAAHELAPLPAMIADRPRLRTMLGSLARTLHVGPLADC
FT                   FFDPATALCLNRSSEPGASGPMISMCEPVRCPNACIAERHRPAWQRGADEARLLLREKR
FT                   LPEPQRVTLQAEVARIQRVLEQIAPGTATPHNGMAGEEEEAGLRVTD"
     MTVVQLLAES DDERDALPVL MSAPLRPGCD RAHISRYGDP VWDLAPGVFR DNARRCHVTV        60
     HFGGIKDPSI ADALRQILHA RLNVDLPGHR SRLEPAGVRG EANRTLRFFD FVKAQLGRFD       120
     LARVDQALVD RYAGALRLAG LRPVAAAALL RIVFDLHELQ HHLPTARLSF EPWPGRSPFS       180
     VAGAKHIAGE NRTPRIPEAI MTPLLSWSLR YVTCYAGDIL AARAELDCLE ATRNRLIAAE       240
     EGLDPAVRRL RQRQRLLDYV ASLRQHGRGI PIWTTAHNGA TRTDPQTGAV TPPINYHLIH       300
     LHAGINAQAE PAMHLGLATG APDLIAAAIA ELGTEIGGMD TPNSADPDTG MPWRTRFDAK       360
     VLPLEEVMLQ SAAYIVCAFL SGMRDSEIQA MRRGCLSITK AEDGTILRHR IKSTAYKGKR       420
     GGGEETEWVT IAPVAEAIDV LERLSARAGQ ARGTTTLWPV LTLRANTKTH VSAEIVRQLN       480
     RFRDHLNDHF GSAQAPVIPA GPDGRPWRLT TRQFRRTIAW HIANRPFGTI AGMIQYKHAS       540
     VAAFEGYAGS SRSGFRGEIE AQRALGQIDD ILVYFDERQS GARLGGPAAN RVGVVLDTAA       600
     HELAPLPAMI ADRPRLRTML GSLARTLHVG PLADCFFDPA TALCLNRSSE PGASGPMISM       660
     CEPVRCPNAC IAERHRPAWQ RGADEARLLL REKRLPEPQR VTLQAEVARI QRVLEQIAPG       720
     TATPHNGMAG EEEEAGLRVT D                                                 741
//

If you have problems or comments...

PBIL Back to PBIL home page