(data stored in ACNUC7421 zone)

EMBL: AP010803.PE421

AP010803.PE421       Location/Qualifiers
FT   CDS             439958..440860
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ardC"
FT                   /locus_tag="SJA_C1-04210"
FT                   /product="antirestriction protein ArdC"
FT                   /note="antirestriction protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04210"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95255"
FT                   /db_xref="InterPro:IPR013610"
FT                   /db_xref="InterPro:IPR017113"
FT                   /db_xref="InterPro:IPR041459"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY23"
FT                   /protein_id="BAI95255.1"
FT                   /translation="MSRSYPATPRADVYSRITTEIVSAIEAGAGDWRMPWHHDGAATTR
FT                   PQNVTSRRRYRGVNVLALWIAAEAAAYSSGLWGTYRQWASLGAQVRKGERGTTVVFWKQ
FT                   AASRADDDHDDGEAGPGRMFARAFTVFNLAQVEGYEPPPVAVLPEGERFGHAEAFVAAL
FT                   KIPITEGAYDAHYRIDLDHIFMPTFASFRDASAQMGTLLHEAAHATGAKHRLDRNFAER
FT                   FKRDSLAIEEICAELTASFVLADLRIAHHPRADHAAYVASWLRALKDDPRAIFTAASKA
FT                   QAAADWMHAQQPQPEEIAA"
     MSRSYPATPR ADVYSRITTE IVSAIEAGAG DWRMPWHHDG AATTRPQNVT SRRRYRGVNV        60
     LALWIAAEAA AYSSGLWGTY RQWASLGAQV RKGERGTTVV FWKQAASRAD DDHDDGEAGP       120
     GRMFARAFTV FNLAQVEGYE PPPVAVLPEG ERFGHAEAFV AALKIPITEG AYDAHYRIDL       180
     DHIFMPTFAS FRDASAQMGT LLHEAAHATG AKHRLDRNFA ERFKRDSLAI EEICAELTAS       240
     FVLADLRIAH HPRADHAAYV ASWLRALKDD PRAIFTAASK AQAAADWMHA QQPQPEEIAA       300
//

If you have problems or comments...

PBIL Back to PBIL home page