(data stored in ACNUC7421 zone)

EMBL: AP010803.PE422

AP010803.PE422       Location/Qualifiers
FT   CDS             440857..441138
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="ardC"
FT                   /locus_tag="SJA_C1-04220"
FT                   /product="antirestriction protein ArdC"
FT                   /note="remnant"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04220"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95256"
FT                   /db_xref="InterPro:IPR041459"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY24"
FT                   /protein_id="BAI95256.1"
FT                   /translation="MISAPKICGRSHIRAGLSGYVAELTAALVGADVGLPTTHLDDHAA
FT                   YIGSWLAILRKDNRALLTAAARAEEAAGFLLRATDLACEDDLDEQAAA"
     MISAPKICGR SHIRAGLSGY VAELTAALVG ADVGLPTTHL DDHAAYIGSW LAILRKDNRA        60
     LLTAAARAEE AAGFLLRATD LACEDDLDEQ AAA                                     93
//

If you have problems or comments...

PBIL Back to PBIL home page