(data stored in ACNUC7421 zone)

EMBL: AP010803.PE425

AP010803.PE425       Location/Qualifiers
FT   CDS             442075..442515
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="arsC"
FT                   /locus_tag="SJA_C1-04250"
FT                   /product="arsenate reductase"
FT                   /EC_number="1.20.4.1"
FT                   /note="arsenate reductase or related protein, glutaredoxin
FT                   family"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04250"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95259"
FT                   /db_xref="GOA:D4YY27"
FT                   /db_xref="InterPro:IPR006659"
FT                   /db_xref="InterPro:IPR006660"
FT                   /db_xref="InterPro:IPR036249"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY27"
FT                   /protein_id="BAI95259.1"
FT                   /translation="MSNAAIDIVIYHNPECGTSRNTLAMIRNAGIEPHVIEYLKTPPNR
FT                   PRLVSLIARMGISARQLLREKGTPFAELGLADPTLSDDQLIDAMIEHPILINRPIVVSP
FT                   LGVKLCRPSEEVLDLLPSAQRGAFTKEDGEQVIDAAGKRIGA"
     MSNAAIDIVI YHNPECGTSR NTLAMIRNAG IEPHVIEYLK TPPNRPRLVS LIARMGISAR        60
     QLLREKGTPF AELGLADPTL SDDQLIDAMI EHPILINRPI VVSPLGVKLC RPSEEVLDLL       120
     PSAQRGAFTK EDGEQVIDAA GKRIGA                                            146
//

If you have problems or comments...

PBIL Back to PBIL home page