(data stored in ACNUC7421 zone)

EMBL: AP010803.PE43

AP010803.PE43        Location/Qualifiers
FT   CDS             complement(45319..45771)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00430"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00430"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94877"
FT                   /db_xref="InterPro:IPR021959"
FT                   /db_xref="UniProtKB/TrEMBL:D4YWZ5"
FT                   /protein_id="BAI94877.1"
FT                   /translation="MMVRRLSSRLSAGLLLAALLPLAACGGGAKDRPKADLAASKVTTI
FT                   GVNAYLWRASLDTLSFMPMVQTDSNGGVIVTDWYANPNSPNERMKLTVSILDQDLRADA
FT                   LRVAASRQVSQGGQWVDVPVQAATVQKLEEIILTKARDLRRMAIAG"
     MMVRRLSSRL SAGLLLAALL PLAACGGGAK DRPKADLAAS KVTTIGVNAY LWRASLDTLS        60
     FMPMVQTDSN GGVIVTDWYA NPNSPNERMK LTVSILDQDL RADALRVAAS RQVSQGGQWV       120
     DVPVQAATVQ KLEEIILTKA RDLRRMAIAG                                        150
//

If you have problems or comments...

PBIL Back to PBIL home page