(data stored in ACNUC7421 zone)

EMBL: AP010803.PE430

AP010803.PE430       Location/Qualifiers
FT   CDS             446149..446817
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04300"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04300"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95264"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY32"
FT                   /protein_id="BAI95264.1"
FT                   /translation="MFMPDRASACALLAFRAAHGRHWKAKLLSLWSTGRDVDEADGAYL
FT                   RHLRNQAGPSWLRQLTPRRWRAIERLAAPGDPVLAAVFLDRAREFHRGAQIGAPIALAP
FT                   ALHLLAISCELGLKAHLLGHGWTDDALARDIRHDLVRALDEARQLGLPAPGRPLADFIK
FT                   SLGPAYAVHRIDALVAGGYACDIGAVLCETGQLLDAVAACLRPATPGAATLRTSSSPSA
FT                   "
     MFMPDRASAC ALLAFRAAHG RHWKAKLLSL WSTGRDVDEA DGAYLRHLRN QAGPSWLRQL        60
     TPRRWRAIER LAAPGDPVLA AVFLDRAREF HRGAQIGAPI ALAPALHLLA ISCELGLKAH       120
     LLGHGWTDDA LARDIRHDLV RALDEARQLG LPAPGRPLAD FIKSLGPAYA VHRIDALVAG       180
     GYACDIGAVL CETGQLLDAV AACLRPATPG AATLRTSSSP SA                          222
//

If you have problems or comments...

PBIL Back to PBIL home page