(data stored in ACNUC7421 zone)

EMBL: AP010803.PE431

AP010803.PE431       Location/Qualifiers
FT   CDS             complement(446866..447069)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04310"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04310"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95265"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY33"
FT                   /protein_id="BAI95265.1"
FT                   /translation="MACGLDGPDGRLRGQMRRRTVRRLGHDRSPPSETADIAGFAEHAG
FT                   PASRGPYARALSARPLSRRTGL"
     MACGLDGPDG RLRGQMRRRT VRRLGHDRSP PSETADIAGF AEHAGPASRG PYARALSARP        60
     LSRRTGL                                                                  67
//

If you have problems or comments...

PBIL Back to PBIL home page