(data stored in ACNUC7421 zone)

EMBL: AP010803.PE432

AP010803.PE432       Location/Qualifiers
FT   CDS             447225..447632
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04320"
FT                   /product="single-stranded DNA-binding protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04320"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95266"
FT                   /db_xref="GOA:D4YY34"
FT                   /db_xref="InterPro:IPR000424"
FT                   /db_xref="InterPro:IPR011344"
FT                   /db_xref="InterPro:IPR012340"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY34"
FT                   /protein_id="BAI95266.1"
FT                   /translation="MQNLVILAGNVGGTPETRTTQGGTRITHFSLATSRPKRDSNGKIL
FT                   RDDNNRRLEDTEWHRITCFNGVGKTVEQYVDKGMKVMVRGRIHYTRWTDSENIERYGVE
FT                   IIADEVTFLTRAKSNENSGGGNEPEDDEIPF"
     MQNLVILAGN VGGTPETRTT QGGTRITHFS LATSRPKRDS NGKILRDDNN RRLEDTEWHR        60
     ITCFNGVGKT VEQYVDKGMK VMVRGRIHYT RWTDSENIER YGVEIIADEV TFLTRAKSNE       120
     NSGGGNEPED DEIPF                                                        135
//

If you have problems or comments...

PBIL Back to PBIL home page