(data stored in SCRATCH zone)

EMBL: AP010803.PE433

AP010803.PE433       Location/Qualifiers
FT   CDS             complement(447708..448142)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04330"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04330"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95267"
FT                   /db_xref="InterPro:IPR035437"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY35"
FT                   /protein_id="BAI95267.1"
FT                   /translation="MLFPLLLAAAVVPNGQTFACTPTRVWDGDGPIWCREGAHVRLAGI
FT                   AAREIDNSCRPGQPCPRASGPAARDALVRLLGGPRGQTSTGHIRVAGPTMRCVSTGEAK
FT                   GNRTGAWCNAPGIGDLSCAMIATGTVLRWERYAKGRCRSR"
     MLFPLLLAAA VVPNGQTFAC TPTRVWDGDG PIWCREGAHV RLAGIAAREI DNSCRPGQPC        60
     PRASGPAARD ALVRLLGGPR GQTSTGHIRV AGPTMRCVST GEAKGNRTGA WCNAPGIGDL       120
     SCAMIATGTV LRWERYAKGR CRSR                                              144
//

If you have problems or comments...

PBIL Back to PBIL home page