(data stored in SCRATCH zone)

EMBL: AP010803.PE434

AP010803.PE434       Location/Qualifiers
FT   CDS             448371..448613
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04340"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04340"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95268"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY36"
FT                   /protein_id="BAI95268.1"
FT                   /translation="MIAATGRTHRAPVERDEPAGAQRSLDMFTDIAIARRHAFSLSRSL
FT                   MMVTFVIAIGQHYGVITAEDADGSVAIVTEFDPFA"
     MIAATGRTHR APVERDEPAG AQRSLDMFTD IAIARRHAFS LSRSLMMVTF VIAIGQHYGV        60
     ITAEDADGSV AIVTEFDPFA                                                    80
//

If you have problems or comments...

PBIL Back to PBIL home page