(data stored in ACNUC7421 zone)

EMBL: AP010803.PE435

AP010803.PE435       Location/Qualifiers
FT   CDS             448691..449242
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04350"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04350"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95269"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY37"
FT                   /protein_id="BAI95269.1"
FT                   /translation="MFRCRAYAAIMTIEAAIANAGDDALWARVTQEVNAWRGACLQCFA
FT                   AVEVAVTETLLHLSAQPGRGQSVKLRHLVGQRLDDLAALVNEGGPFSVEGKGVASLLAE
FT                   FRHQEGLRTMLAHGQAKLTVERTSRWAAIFRVIAIRARQADRSTLVIEESEAVERPQQL
FT                   RKVSQKLCSALGNLRRAVAV"
     MFRCRAYAAI MTIEAAIANA GDDALWARVT QEVNAWRGAC LQCFAAVEVA VTETLLHLSA        60
     QPGRGQSVKL RHLVGQRLDD LAALVNEGGP FSVEGKGVAS LLAEFRHQEG LRTMLAHGQA       120
     KLTVERTSRW AAIFRVIAIR ARQADRSTLV IEESEAVERP QQLRKVSQKL CSALGNLRRA       180
     VAV                                                                     183
//

If you have problems or comments...

PBIL Back to PBIL home page