(data stored in ACNUC7421 zone)

EMBL: AP010803.PE437

AP010803.PE437       Location/Qualifiers
FT   CDS             449992..450384
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04370"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04370"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95271"
FT                   /db_xref="GOA:D4YY39"
FT                   /db_xref="InterPro:IPR022243"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY39"
FT                   /protein_id="BAI95271.1"
FT                   /translation="MSQSSPNAMSQAERIARVAELNDALRRSIHSPGRNQIVMTAGVAA
FT                   LIGDVALFRGFRRRAEIIRIVRDYDSFTPDNDPVGEHDFGRFEFEDAILYWKIDYYDLE
FT                   LAYGSADAAKPEVTTRVLTILLADEY"
     MSQSSPNAMS QAERIARVAE LNDALRRSIH SPGRNQIVMT AGVAALIGDV ALFRGFRRRA        60
     EIIRIVRDYD SFTPDNDPVG EHDFGRFEFE DAILYWKIDY YDLELAYGSA DAAKPEVTTR       120
     VLTILLADEY                                                              130
//

If you have problems or comments...

PBIL Back to PBIL home page