(data stored in ACNUC7421 zone)

EMBL: AP010803.PE439

AP010803.PE439       Location/Qualifiers
FT   CDS             450766..451530
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04390"
FT                   /product="ParA-like protein"
FT                   /note="ATPase involved in chromosome partitioning"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04390"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95273"
FT                   /db_xref="InterPro:IPR025669"
FT                   /db_xref="InterPro:IPR027417"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY41"
FT                   /protein_id="BAI95273.1"
FT                   /translation="MKTIVVSLLKGGVGKTFLATHLAWYLAEPPERRVAFVDLDPQGSS
FT                   TRRLGAERQGGFAADLFDPAATLCADGQAGLTVLGADPRLQMVKAAQDVRDFIGRFPAL
FT                   RPHFDYCVIDTGPKWDELTLSAMAVADAVIAPVQVAEDSVQCAKMLLTALRKAEAARAG
FT                   RKIAFLGLLPSMVNPFDRREMENAVKLAHAVGEKLMFPAFIKARPTYKHAAENHRPVWQ
FT                   ETGSGAKAAAEEIRAVLAEIERRMTSQEVAAA"
     MKTIVVSLLK GGVGKTFLAT HLAWYLAEPP ERRVAFVDLD PQGSSTRRLG AERQGGFAAD        60
     LFDPAATLCA DGQAGLTVLG ADPRLQMVKA AQDVRDFIGR FPALRPHFDY CVIDTGPKWD       120
     ELTLSAMAVA DAVIAPVQVA EDSVQCAKML LTALRKAEAA RAGRKIAFLG LLPSMVNPFD       180
     RREMENAVKL AHAVGEKLMF PAFIKARPTY KHAAENHRPV WQETGSGAKA AAEEIRAVLA       240
     EIERRMTSQE VAAA                                                         254
//

If you have problems or comments...

PBIL Back to PBIL home page