(data stored in ACNUC7421 zone)

EMBL: AP010803.PE44

AP010803.PE44        Location/Qualifiers
FT   CDS             45996..46727
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00440"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94878"
FT                   /db_xref="UniProtKB/TrEMBL:D4YWZ6"
FT                   /protein_id="BAI94878.1"
FT                   /translation="MRLKRGHIALAGSAVAVAGFMLSPAIGAAADLVRMRAETPVSLGA
FT                   LGSISSFTPTTKDPRLAAAYAKIAASASRQNFRFTPTSGSLSGQRSVTVMVRAADLNDR
FT                   VAVSRTLDPVNIAPVAFSLNSAHNWRKFALPEAVGRKELDPVAVEPMAGARNFSLDQGR
FT                   KDRFSTKVLIESRREPAATIRNPSADKDYSLDLASSYSLTRNLNVTAGVRYNNSFAGRL
FT                   TPMTDDRQDAQAVYLGTIFKF"
     MRLKRGHIAL AGSAVAVAGF MLSPAIGAAA DLVRMRAETP VSLGALGSIS SFTPTTKDPR        60
     LAAAYAKIAA SASRQNFRFT PTSGSLSGQR SVTVMVRAAD LNDRVAVSRT LDPVNIAPVA       120
     FSLNSAHNWR KFALPEAVGR KELDPVAVEP MAGARNFSLD QGRKDRFSTK VLIESRREPA       180
     ATIRNPSADK DYSLDLASSY SLTRNLNVTA GVRYNNSFAG RLTPMTDDRQ DAQAVYLGTI       240
     FKF                                                                     243
//

If you have problems or comments...

PBIL Back to PBIL home page