(data stored in SCRATCH zone)

EMBL: AP010803.PE441

AP010803.PE441       Location/Qualifiers
FT   CDS             452683..453243
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04410"
FT                   /product="putative mobilization protein"
FT                   /note="GTPase SAR1 or related small G protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04410"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95275"
FT                   /db_xref="InterPro:IPR008687"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY43"
FT                   /protein_id="BAI95275.1"
FT                   /translation="MYDNSVGDMPVLTFRLDDDVAQRFAALAAASGGRSALLRRLIGDA
FT                   LAMEAGEGHQAPRARQRATCRVEVRLIPEEIAALDREADALGMKRTDWITTLLARRLRA
FT                   NAPLPREERAAVAQAWRELNRIGINLNQATRALNASVMVESGLDVAREAARVASFRSEI
FT                   VDALAGLGAALKGDLRYWDMADA"
     MYDNSVGDMP VLTFRLDDDV AQRFAALAAA SGGRSALLRR LIGDALAMEA GEGHQAPRAR        60
     QRATCRVEVR LIPEEIAALD READALGMKR TDWITTLLAR RLRANAPLPR EERAAVAQAW       120
     RELNRIGINL NQATRALNAS VMVESGLDVA REAARVASFR SEIVDALAGL GAALKGDLRY       180
     WDMADA                                                                  186
//

If you have problems or comments...

PBIL Back to PBIL home page