(data stored in ACNUC7421 zone)

EMBL: AP010803.PE443

AP010803.PE443       Location/Qualifiers
FT   CDS             454528..455136
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04430"
FT                   /product="hypothetical protein"
FT                   /note="polyketide synthase module or related protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04430"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95277"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY45"
FT                   /protein_id="BAI95277.1"
FT                   /translation="MSAVADRIMKRVRGKGRGWVFTPKSFVDFGTRGSVDMALSRLASA
FT                   GDIRRIGRGLYDYPRQHDKLGALSPDPANVAKALSTQSGDKLAPSGATAANNLGLSTQV
FT                   PARASYATTGRSRVRQAGGRSLTLKHSRAPVLDNAPDSVNAIVQALAHLGKDNIDSGKI
FT                   RHFATRLDDRDMRILIQARPAMPGWMGDVVLKIGAARNG"
     MSAVADRIMK RVRGKGRGWV FTPKSFVDFG TRGSVDMALS RLASAGDIRR IGRGLYDYPR        60
     QHDKLGALSP DPANVAKALS TQSGDKLAPS GATAANNLGL STQVPARASY ATTGRSRVRQ       120
     AGGRSLTLKH SRAPVLDNAP DSVNAIVQAL AHLGKDNIDS GKIRHFATRL DDRDMRILIQ       180
     ARPAMPGWMG DVVLKIGAAR NG                                                202
//

If you have problems or comments...

PBIL Back to PBIL home page