(data stored in ACNUC7421 zone)

EMBL: AP010803.PE444

AP010803.PE444       Location/Qualifiers
FT   CDS             455129..456178
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04440"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04440"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95278"
FT                   /db_xref="InterPro:IPR014942"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY46"
FT                   /protein_id="BAI95278.1"
FT                   /translation="MDEFARRPAEDRRAYIDEAAARRDLTPIIIEKDFWVCWTLRRLIM
FT                   CPDLVGHMTFKGGTSLSKAYGIIARFSEDIDLTISRSAPLLDKVASPMDDDITGKERER
FT                   RTKALKAAAQAYVATVAMPILAREIETALGTGEGWSLALDPDDKDQQTLLFVYPRSSGY
FT                   GLAYGENYGGADESGYIKPRIKLEFGARGDTEPFELRPISSYLTEDFPEELPNALTEVP
FT                   TLAVARTFWEKVTILHAIHHNGKLREGMSRHYYDVLMLDQAGITAEALARITLLEQVVH
FT                   NKSLMFADKSASYETAVPGTLRLSPDGATQEKLERDYGAMSEMFMAAPPKFDALMKGLA
FT                   AIEAAINGR"
     MDEFARRPAE DRRAYIDEAA ARRDLTPIII EKDFWVCWTL RRLIMCPDLV GHMTFKGGTS        60
     LSKAYGIIAR FSEDIDLTIS RSAPLLDKVA SPMDDDITGK ERERRTKALK AAAQAYVATV       120
     AMPILAREIE TALGTGEGWS LALDPDDKDQ QTLLFVYPRS SGYGLAYGEN YGGADESGYI       180
     KPRIKLEFGA RGDTEPFELR PISSYLTEDF PEELPNALTE VPTLAVARTF WEKVTILHAI       240
     HHNGKLREGM SRHYYDVLML DQAGITAEAL ARITLLEQVV HNKSLMFADK SASYETAVPG       300
     TLRLSPDGAT QEKLERDYGA MSEMFMAAPP KFDALMKGLA AIEAAINGR                   349
//

If you have problems or comments...

PBIL Back to PBIL home page