(data stored in ACNUC7421 zone)

EMBL: AP010803.PE447

AP010803.PE447       Location/Qualifiers
FT   CDS             459180..459383
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04470"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04470"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95281"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY49"
FT                   /protein_id="BAI95281.1"
FT                   /translation="MITAKHIPWEPIATLPEDRKDGRRLLLWEVDLPVIGRWDSDREGW
FT                   EDPESMHILEEVTHWADINPPV"
     MITAKHIPWE PIATLPEDRK DGRRLLLWEV DLPVIGRWDS DREGWEDPES MHILEEVTHW        60
     ADINPPV                                                                  67
//

If you have problems or comments...

PBIL Back to PBIL home page