(data stored in ACNUC7421 zone)

EMBL: AP010803.PE448

AP010803.PE448       Location/Qualifiers
FT   CDS             459559..459897
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04480"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95282"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY50"
FT                   /protein_id="BAI95282.1"
FT                   /translation="MATIAPTKPVTVAFPKSDVIAALVAELIEVAKAEAQVRGIPLPPD
FT                   NPEIIKAPIPMDSLSVVDTLCALEPVVGFELRESIVRTGGYSSIEAALEHLVPKIERVW
FT                   IRKKGSKP"
     MATIAPTKPV TVAFPKSDVI AALVAELIEV AKAEAQVRGI PLPPDNPEII KAPIPMDSLS        60
     VVDTLCALEP VVGFELRESI VRTGGYSSIE AALEHLVPKI ERVWIRKKGS KP               112
//

If you have problems or comments...

PBIL Back to PBIL home page