(data stored in ACNUC7421 zone)

EMBL: AP010803.PE45

AP010803.PE45        Location/Qualifiers
FT   CDS             complement(46806..47300)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00450"
FT                   /product="conserved hypothetical protein"
FT                   /note="putative membrane protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00450"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94879"
FT                   /db_xref="UniProtKB/TrEMBL:D4YWZ7"
FT                   /protein_id="BAI94879.1"
FT                   /translation="MPLALLYALAGCGSDETPAANIAQPHASTPIAMPAPTLRQGTENR
FT                   AKTVPRETGERSPVGAPPVKHYADDDYRAIGTEPFWAVTVNGSTAVLERPDKAPVRYAI
FT                   TRNDDKRALRFLGEGFSMTVTEGPCSDGMSDALWSDRVAVAFGEGTLNGCGGLRDDLDE
FT                   P"
     MPLALLYALA GCGSDETPAA NIAQPHASTP IAMPAPTLRQ GTENRAKTVP RETGERSPVG        60
     APPVKHYADD DYRAIGTEPF WAVTVNGSTA VLERPDKAPV RYAITRNDDK RALRFLGEGF       120
     SMTVTEGPCS DGMSDALWSD RVAVAFGEGT LNGCGGLRDD LDEP                        164
//

If you have problems or comments...

PBIL Back to PBIL home page