(data stored in ACNUC7421 zone)

EMBL: AP010803.PE450

AP010803.PE450       Location/Qualifiers
FT   CDS             460271..461281
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04500"
FT                   /product="conserved hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04500"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95284"
FT                   /db_xref="InterPro:IPR010359"
FT                   /db_xref="InterPro:IPR018990"
FT                   /db_xref="InterPro:IPR036331"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY52"
FT                   /protein_id="BAI95284.1"
FT                   /translation="MALDYASAVRAGAMAAGRLHRQLSTREVIEQQGGNVDVFGAIHAV
FT                   DLPLLLRPLKGLLGAYLSDPAHGVLVTTERPMSIQRFTAAHELGHFSMQHQPSLDDESI
FT                   LRRMPTSPEPGGLFQETEADAFAIAFMMPKWLILSHSARQDWQVDDFRRANVVYQLSLR
FT                   LGASYEATCRTLLRYNLISQSTMTDLLRTQPRALKIDLLKDYRPANYRGDVWLLTERDA
FT                   GTRIDGSRNDLFVLRLKEHSGGGYLWDFDQLIASGFAIVRDDREAVDADAIGGPVVRRV
FT                   TAAIEAAQRGRMSIEERRPWQPVPALAHLTFDFDLTGPEPEGLSRAERRHLLEAA"
     MALDYASAVR AGAMAAGRLH RQLSTREVIE QQGGNVDVFG AIHAVDLPLL LRPLKGLLGA        60
     YLSDPAHGVL VTTERPMSIQ RFTAAHELGH FSMQHQPSLD DESILRRMPT SPEPGGLFQE       120
     TEADAFAIAF MMPKWLILSH SARQDWQVDD FRRANVVYQL SLRLGASYEA TCRTLLRYNL       180
     ISQSTMTDLL RTQPRALKID LLKDYRPANY RGDVWLLTER DAGTRIDGSR NDLFVLRLKE       240
     HSGGGYLWDF DQLIASGFAI VRDDREAVDA DAIGGPVVRR VTAAIEAAQR GRMSIEERRP       300
     WQPVPALAHL TFDFDLTGPE PEGLSRAERR HLLEAA                                 336
//

If you have problems or comments...

PBIL Back to PBIL home page