(data stored in ACNUC7421 zone)

EMBL: AP010803.PE452

AP010803.PE452       Location/Qualifiers
FT   CDS             461939..462718
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04520"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04520"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95286"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY54"
FT                   /protein_id="BAI95286.1"
FT                   /translation="MYLPVPSQPDCVSAWREAVRVVDGAPGHQAYNVIIDVADPSARAT
FT                   LADPVVAEVDAFLAGRGKKPIETVANTIFPAALYHRHGAPLFFDRFRDNVLPKVRLKEA
FT                   WSGYYFERMMQLPQLDGPPINQIWGIVERLRNPKVRALNKFELSVFDPARDVNDSPYGG
FT                   QCLSFASLKLIGKGDQRRIAMTAFYRNHFYIEKLLGNLIGLGRLQSFIAKEGGVGLGPM
FT                   TIVSTHAEIDTGKWNRGDLQQLFARCDQASAQLLAAA"
     MYLPVPSQPD CVSAWREAVR VVDGAPGHQA YNVIIDVADP SARATLADPV VAEVDAFLAG        60
     RGKKPIETVA NTIFPAALYH RHGAPLFFDR FRDNVLPKVR LKEAWSGYYF ERMMQLPQLD       120
     GPPINQIWGI VERLRNPKVR ALNKFELSVF DPARDVNDSP YGGQCLSFAS LKLIGKGDQR       180
     RIAMTAFYRN HFYIEKLLGN LIGLGRLQSF IAKEGGVGLG PMTIVSTHAE IDTGKWNRGD       240
     LQQLFARCDQ ASAQLLAAA                                                    259
//

If you have problems or comments...

PBIL Back to PBIL home page