(data stored in ACNUC7421 zone)

EMBL: AP010803.PE453

AP010803.PE453       Location/Qualifiers
FT   CDS             complement(462685..463389)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04530"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04530"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95287"
FT                   /db_xref="InterPro:IPR036895"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY55"
FT                   /protein_id="BAI95287.1"
FT                   /translation="MTPKHFVSTLAATELPSVFNPWRDRCAVHDRRDAAAKRRDNLERL
FT                   LIAALDAKVETIWIARDLGYRGGRRTGVPLTDEVHLDRAGALMGGIALQRATQGPAVAE
FT                   RTAAIVWRVLEQIGQPVMLWNVFPFHPHEAGDPLSNRCHTRGEREATWPLLQALIAMLN
FT                   PRRIVAIGRDAHLALGDVGIPTTAVRHPSYGGQRDFIEGMFAMYGIDGGALETPRLPLE
FT                   APYAAARSCALA"
     MTPKHFVSTL AATELPSVFN PWRDRCAVHD RRDAAAKRRD NLERLLIAAL DAKVETIWIA        60
     RDLGYRGGRR TGVPLTDEVH LDRAGALMGG IALQRATQGP AVAERTAAIV WRVLEQIGQP       120
     VMLWNVFPFH PHEAGDPLSN RCHTRGEREA TWPLLQALIA MLNPRRIVAI GRDAHLALGD       180
     VGIPTTAVRH PSYGGQRDFI EGMFAMYGID GGALETPRLP LEAPYAAARS CALA             234
//

If you have problems or comments...

PBIL Back to PBIL home page