(data stored in ACNUC7421 zone)

EMBL: AP010803.PE454

AP010803.PE454       Location/Qualifiers
FT   CDS             complement(463386..464564)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04540"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04540"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95288"
FT                   /db_xref="InterPro:IPR004518"
FT                   /db_xref="InterPro:IPR041407"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY56"
FT                   /protein_id="BAI95288.1"
FT                   /translation="MSGEFEALTIDDYAKQAARTDQRSGKSALGFSMLGLFGEAGSLLS
FT                   EAKKKQRDAASYLGYADAVAEELGDVLWYLAAVARRSALALSDIAANAARGDDEWRAGN
FT                   NGALSFHALQPAHIPLVKAPMPQFEHTLLALAGEVGVLVNSFQLGTLTRDKAMLARQLV
FT                   AVMRRLIQAANDSGVTIEAAAVKNLHKIFDRWPREKVYPAPFDAMMDPEEHLPRRMTID
FT                   VYERKVRGQTFVYQRSSGVYVGDRLTDNAVEPDDYRFHDVFHYAHVAVLGWSPVIRALL
FT                   RLKRKSDPKLDDAEDGARAILIEEGVTSWIFGQAQQLRYFDKVKSGGLPLDMLKHVRQF
FT                   VVGYESERCPLWLWEEAILQGYAAFRFLQKHRRGRVTIDFAHRRLLIKELPS"
     MSGEFEALTI DDYAKQAART DQRSGKSALG FSMLGLFGEA GSLLSEAKKK QRDAASYLGY        60
     ADAVAEELGD VLWYLAAVAR RSALALSDIA ANAARGDDEW RAGNNGALSF HALQPAHIPL       120
     VKAPMPQFEH TLLALAGEVG VLVNSFQLGT LTRDKAMLAR QLVAVMRRLI QAANDSGVTI       180
     EAAAVKNLHK IFDRWPREKV YPAPFDAMMD PEEHLPRRMT IDVYERKVRG QTFVYQRSSG       240
     VYVGDRLTDN AVEPDDYRFH DVFHYAHVAV LGWSPVIRAL LRLKRKSDPK LDDAEDGARA       300
     ILIEEGVTSW IFGQAQQLRY FDKVKSGGLP LDMLKHVRQF VVGYESERCP LWLWEEAILQ       360
     GYAAFRFLQK HRRGRVTIDF AHRRLLIKEL PS                                     392
//

If you have problems or comments...

PBIL Back to PBIL home page