(data stored in ACNUC7421 zone)

EMBL: AP010803.PE462

AP010803.PE462       Location/Qualifiers
FT   CDS             complement(471443..471784)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04620"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04620"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95296"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY64"
FT                   /protein_id="BAI95296.1"
FT                   /translation="MTFPFPRISASSFRRSVACLVGGLAVLGVAGCASGPKKLAVCNGH
FT                   RLRDVNIYGSVLPGSPVPATTAPRVAPPIPPLSHPRDGDPPPPPAVPSPSTSDDKVSFA
FT                   PRGSHYASC"
     MTFPFPRISA SSFRRSVACL VGGLAVLGVA GCASGPKKLA VCNGHRLRDV NIYGSVLPGS        60
     PVPATTAPRV APPIPPLSHP RDGDPPPPPA VPSPSTSDDK VSFAPRGSHY ASC              113
//

If you have problems or comments...

PBIL Back to PBIL home page