(data stored in ACNUC7421 zone)

EMBL: AP010803.PE470

AP010803.PE470       Location/Qualifiers
FT   CDS             complement(477845..478777)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04700"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04700"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95304"
FT                   /db_xref="InterPro:IPR008775"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY72"
FT                   /protein_id="BAI95304.1"
FT                   /translation="MATIAPRGVSAATKADENLRQHGFCILRDVESRSRIEEINRSLHP
FT                   RFAATPFCQGGFYGPRTKRFGGLLKRAPTVESLVQNPAVMRLVHAILEPWCDTVQLNLT
FT                   QALELHPGAPAQFPHRDQDMWRGPTGELEYLVNVMWPISPFKAENGATLVWPGSHNGGQ
FT                   GDDGAEPVAIEADPGSAIIFLGSTLHGAGANRSNAVRRGIIVSYCLGWLKPYENQWLTY
FT                   PPEVASAFDPELAALVGYQQHRPNLGNYDGQCPSILLGGDPPDHLAAIDALRPDQEGAL
FT                   SEFLRQQTDQLPPRLGGLPKSSAVGTKER"
     MATIAPRGVS AATKADENLR QHGFCILRDV ESRSRIEEIN RSLHPRFAAT PFCQGGFYGP        60
     RTKRFGGLLK RAPTVESLVQ NPAVMRLVHA ILEPWCDTVQ LNLTQALELH PGAPAQFPHR       120
     DQDMWRGPTG ELEYLVNVMW PISPFKAENG ATLVWPGSHN GGQGDDGAEP VAIEADPGSA       180
     IIFLGSTLHG AGANRSNAVR RGIIVSYCLG WLKPYENQWL TYPPEVASAF DPELAALVGY       240
     QQHRPNLGNY DGQCPSILLG GDPPDHLAAI DALRPDQEGA LSEFLRQQTD QLPPRLGGLP       300
     KSSAVGTKER                                                              310
//

If you have problems or comments...

PBIL Back to PBIL home page