(data stored in SCRATCH zone)

EMBL: AP010803.PE472

AP010803.PE472       Location/Qualifiers
FT   CDS             complement(479475..480221)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /gene="luxR"
FT                   /locus_tag="SJA_C1-04720"
FT                   /product="LuxR-family transcriptional regulator"
FT                   /note="DNA-binding HTH domain-containing protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04720"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95306"
FT                   /db_xref="GOA:D4YY74"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR005143"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="InterPro:IPR036693"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY74"
FT                   /protein_id="BAI95306.1"
FT                   /translation="MMIGLGQVQDFCAVAGAIKDATALSDLMAEITKAMGFRHYALVHH
FT                   VDLKPAVRSVHIVDYPQDWVERFQARRLYASDPIHRASHRTNVGFAWSAVQSIISLTAA
FT                   DRSILAEAYEAGLGDGFTVPAHIPGELNGSCSFAMAAGEMLDHRQLPFVQLVGSFAFEA
FT                   ARKISRIHAPQSEWPSLTERQAECVALVARGKTDWEISQILGIGQETVIQHVKDARDRY
FT                   GVTKRTLLAIRALFDGQISFADVFGR"
     MMIGLGQVQD FCAVAGAIKD ATALSDLMAE ITKAMGFRHY ALVHHVDLKP AVRSVHIVDY        60
     PQDWVERFQA RRLYASDPIH RASHRTNVGF AWSAVQSIIS LTAADRSILA EAYEAGLGDG       120
     FTVPAHIPGE LNGSCSFAMA AGEMLDHRQL PFVQLVGSFA FEAARKISRI HAPQSEWPSL       180
     TERQAECVAL VARGKTDWEI SQILGIGQET VIQHVKDARD RYGVTKRTLL AIRALFDGQI       240
     SFADVFGR                                                                248
//

If you have problems or comments...

PBIL Back to PBIL home page