(data stored in ACNUC7421 zone)

EMBL: AP010803.PE474

AP010803.PE474       Location/Qualifiers
FT   CDS             481218..481787
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04740"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04740"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95308"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY76"
FT                   /protein_id="BAI95308.1"
FT                   /translation="MFHAGKPLEPSIGCDVAAVLETLATVSSRPRYAFMLLNLIAQVAG
FT                   PDGSAGPWVRRNDGLVSLRDWLCDALTPMAQRGPRSITLAERVESDLARNGLLPGDPEK
FT                   RRGVIAEEMRARIRTAGKSNLSRAVSELVNAGLLRRHYQGYRVDHRNRGGQRHAVYTLI
FT                   GDALRLVPGISSTPNLPVQGELALPR"
     MFHAGKPLEP SIGCDVAAVL ETLATVSSRP RYAFMLLNLI AQVAGPDGSA GPWVRRNDGL        60
     VSLRDWLCDA LTPMAQRGPR SITLAERVES DLARNGLLPG DPEKRRGVIA EEMRARIRTA       120
     GKSNLSRAVS ELVNAGLLRR HYQGYRVDHR NRGGQRHAVY TLIGDALRLV PGISSTPNLP       180
     VQGELALPR                                                               189
//

If you have problems or comments...

PBIL Back to PBIL home page