(data stored in ACNUC7421 zone)

EMBL: AP010803.PE475

AP010803.PE475       Location/Qualifiers
FT   CDS             complement(481897..482577)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04750"
FT                   /product="putative protein-S-isoprenylcysteine
FT                   methyltransferase"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04750"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95309"
FT                   /db_xref="GOA:D4YY77"
FT                   /db_xref="InterPro:IPR007269"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY77"
FT                   /protein_id="BAI95309.1"
FT                   /translation="MTHADYGYGLWGLALVNAAVFILFAFSFFKPATRRDWRSFGAFSA
FT                   FIVALFAEMYGFPLTIFLLSGWLQSHFPAVDWWSHDAGHLLEMMFGWRVNPHYGPFHIA
FT                   SFVLIGVGYWLISVAWTALHLSQRKHQLALTGIYARIRHPQYVGFILVMLGFLLQWPTL
FT                   LTLAMFPVLVVMYIRLARHEEKEALANFGEVYRDYMARVPGFIPNLTIHSRRRRPWRSF
FT                   DGNG"
     MTHADYGYGL WGLALVNAAV FILFAFSFFK PATRRDWRSF GAFSAFIVAL FAEMYGFPLT        60
     IFLLSGWLQS HFPAVDWWSH DAGHLLEMMF GWRVNPHYGP FHIASFVLIG VGYWLISVAW       120
     TALHLSQRKH QLALTGIYAR IRHPQYVGFI LVMLGFLLQW PTLLTLAMFP VLVVMYIRLA       180
     RHEEKEALAN FGEVYRDYMA RVPGFIPNLT IHSRRRRPWR SFDGNG                      226
//

If you have problems or comments...

PBIL Back to PBIL home page