(data stored in ACNUC7421 zone)

EMBL: AP010803.PE476

AP010803.PE476       Location/Qualifiers
FT   CDS             complement(482574..482837)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04760"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04760"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95310"
FT                   /db_xref="GOA:D4YY78"
FT                   /db_xref="InterPro:IPR021682"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY78"
FT                   /protein_id="BAI95310.1"
FT                   /translation="MGEHDHRMRKRGKIVLIGFLLVASFFLITEHTAHFLGVLPYLILL
FT                   ACPLMHLFMHHGQGGHQHGHEPGQAPAGLPANPNGRIEGESR"
     MGEHDHRMRK RGKIVLIGFL LVASFFLITE HTAHFLGVLP YLILLACPLM HLFMHHGQGG        60
     HQHGHEPGQA PAGLPANPNG RIEGESR                                            87
//

If you have problems or comments...

PBIL Back to PBIL home page