(data stored in ACNUC7421 zone)

EMBL: AP010803.PE48

AP010803.PE48        Location/Qualifiers
FT   CDS             50471..50953
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00480"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00480"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94882"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX00"
FT                   /protein_id="BAI94882.1"
FT                   /translation="MRIVLALALMLAACSKSSDVLEELPNSSLAGAAREDVPETRLESR
FT                   LVRPVTIGEDGPRLDACGAMGQAARVGAGGAPVRAAPFSDAREIARMAEGARAWVCTRS
FT                   LDQKWLGVVLVAEPPADNATAPVDCGVSEPADRKQPYDGPCLSGWVSSAAIRLIAG"
     MRIVLALALM LAACSKSSDV LEELPNSSLA GAAREDVPET RLESRLVRPV TIGEDGPRLD        60
     ACGAMGQAAR VGAGGAPVRA APFSDAREIA RMAEGARAWV CTRSLDQKWL GVVLVAEPPA       120
     DNATAPVDCG VSEPADRKQP YDGPCLSGWV SSAAIRLIAG                             160
//

If you have problems or comments...

PBIL Back to PBIL home page