(data stored in ACNUC7421 zone)

EMBL: AP010803.PE481

AP010803.PE481       Location/Qualifiers
FT   CDS             487552..488187
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04810"
FT                   /product="CheY-like response regulator"
FT                   /note="response regulator containing a CheY-like receiver
FT                   domain and an HTH DNA-binding domain"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04810"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95315"
FT                   /db_xref="GOA:D4YY83"
FT                   /db_xref="InterPro:IPR000792"
FT                   /db_xref="InterPro:IPR001789"
FT                   /db_xref="InterPro:IPR011006"
FT                   /db_xref="InterPro:IPR016032"
FT                   /db_xref="InterPro:IPR036388"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY83"
FT                   /protein_id="BAI95315.1"
FT                   /translation="MGNKRVVHIVDDEETIRKALSFTLRTAGFAVEAYASGPEFLLSAE
FT                   DAEKGCVVLDMHMPDMDGLQVQAELTRRGIDMPVVVLTGNGDPTLAVQAMKAGAADFLA
FT                   KPVEKAALLGAIDRGFSWLESIARRASEQADALSKAARLTQRERAVLRGISRGYPNSLI
FT                   ADELGVTSRTVELHRASLMIKLNAQSLPDLLRIAFAVDLHESTENGHP"
     MGNKRVVHIV DDEETIRKAL SFTLRTAGFA VEAYASGPEF LLSAEDAEKG CVVLDMHMPD        60
     MDGLQVQAEL TRRGIDMPVV VLTGNGDPTL AVQAMKAGAA DFLAKPVEKA ALLGAIDRGF       120
     SWLESIARRA SEQADALSKA ARLTQRERAV LRGISRGYPN SLIADELGVT SRTVELHRAS       180
     LMIKLNAQSL PDLLRIAFAV DLHESTENGH P                                      211
//

If you have problems or comments...

PBIL Back to PBIL home page