(data stored in ACNUC7421 zone)

EMBL: AP010803.PE488

AP010803.PE488       Location/Qualifiers
FT   CDS             493509..493952
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-04880"
FT                   /product="hypothetical protein"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-04880"
FT                   /db_xref="EnsemblGenomes-Tr:BAI95322"
FT                   /db_xref="InterPro:IPR025961"
FT                   /db_xref="UniProtKB/TrEMBL:D4YY90"
FT                   /protein_id="BAI95322.1"
FT                   /translation="MMRDRRRLLLLVLLTFAAAIAGVVIGRVYVVPVRPVENELHELLH
FT                   RDLKLDSAQHSRLETIEKNYAIRRQALEAELRADNARLAEAIEAEHGYGPQVAAAVDRS
FT                   HQAMGALQKETLEHIFAMRAVLRPDQTEKFDDAVVKALTAKSK"
     MMRDRRRLLL LVLLTFAAAI AGVVIGRVYV VPVRPVENEL HELLHRDLKL DSAQHSRLET        60
     IEKNYAIRRQ ALEAELRADN ARLAEAIEAE HGYGPQVAAA VDRSHQAMGA LQKETLEHIF       120
     AMRAVLRPDQ TEKFDDAVVK ALTAKSK                                           147
//

If you have problems or comments...

PBIL Back to PBIL home page