(data stored in ACNUC7421 zone)

EMBL: AP010803.PE49

AP010803.PE49        Location/Qualifiers
FT   CDS             complement(50998..51504)
FT                   /codon_start=1
FT                   /transl_table=11
FT                   /locus_tag="SJA_C1-00490"
FT                   /product="conserved hypothetical protein"
FT                   /note="uncharacterized protein conserved in bacteria"
FT                   /db_xref="EnsemblGenomes-Gn:SJA_C1-00490"
FT                   /db_xref="EnsemblGenomes-Tr:BAI94883"
FT                   /db_xref="InterPro:IPR018531"
FT                   /db_xref="InterPro:IPR034660"
FT                   /db_xref="UniProtKB/TrEMBL:D4YX01"
FT                   /protein_id="BAI94883.1"
FT                   /translation="MATDLYDLTVPVFIRGLRNLSAILEKGAAYAEEKGIDPLTLTQAR
FT                   LTQDMAPLAAQVQYASDSAKGAVIRIGGLDPVPMPDTEQSFADLQERIGKTLAFLESVP
FT                   RDRIDGREDAQVVLRTPRGDFSFTGRSHVLGFSMPNFHFHVTMAYALLRQAGVPLGKLD
FT                   YLGGL"
     MATDLYDLTV PVFIRGLRNL SAILEKGAAY AEEKGIDPLT LTQARLTQDM APLAAQVQYA        60
     SDSAKGAVIR IGGLDPVPMP DTEQSFADLQ ERIGKTLAFL ESVPRDRIDG REDAQVVLRT       120
     PRGDFSFTGR SHVLGFSMPN FHFHVTMAYA LLRQAGVPLG KLDYLGGL                    168
//

If you have problems or comments...

PBIL Back to PBIL home page